PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC052828.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 498aa    MW: 54934.2 Da    PI: 5.9568
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC052828.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.71.1e-32264318155
       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   kpr+rWtpeLH rFv+av++L G+ekAtPk +l+lm+v+gLt++hvkSHLQkYRl
  EcC052828.20 264 KPRMRWTPELHVRFVDAVNKLDGAEKATPKGVLKLMNVEGLTIYHVKSHLQKYRL 318
                   79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.275261321IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-31262319IPR009057Homeodomain-like
SuperFamilySSF466891.97E-17263318IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-24264319IPR006447Myb domain, plants
PfamPF002492.2E-8266317IPR001005SANT/Myb domain
PfamPF143797.8E-23355401IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MNGHSITLPQ SGSTKGMKNS HYTGMSLDHR FLNAESEGIS KASGWSSSSP SPLIRVEPLN  60
LNLSRESTFQ SHKTCSESSP SSPLSLASHV QTPKSTYSRS SVFCTSLYQS SSSTSEAHKH  120
LRSLPFLPHP PAYNQSVSAI DSKSSSLFSE DISNLDDEKH TESLMTDFLG FPGDTSDGSF  180
NGMDCASDNL MLTDQLELQY LSDELDLAIT DNADTPNLDD IYEARLPPSK QETELVCQQK  240
CHSPLPAIDS VSSQPSSGPA AAHKPRMRWT PELHVRFVDA VNKLDGAEKA TPKGVLKLMN  300
VEGLTIYHVK SHLQKYRLAK YMPEKKEEKK GGSSEEKKAM SCGNESDGRR KGSTQITEAL  360
RMQMEVQKQL HEQLEVQREL QLRIEEHARY LQKILEEQQK AGVVLTCPQK MSSSEDACPE  420
SELRPSSPTV AASLPWPAES KYNPKVLSLK NKASESSGTE SHECQQKRIR IEEKAESTSV  480
SDEAVVDNPS EVTQVQSC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010063696.10.0PREDICTED: uncharacterized protein LOC104450718
TrEMBLA0A059BXL90.0A0A059BXL9_EUCGR; Uncharacterized protein
STRINGVIT_09s0054g01620.t011e-166(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-116G2-like family protein